PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_006386-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family ZF-HD
Protein Properties Length: 347aa    MW: 37060.4 Da    PI: 8.0569
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_006386-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1092.7e-34131187360
    ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                    +vrY+eClkNhAas+Ggh+vDGCgEfmps geegt++alkCaAC+CHRnFHR+e+e e
  NNU_006386-RA 131 AVRYRECLKNHAASIGGHVVDGCGEFMPS-GEEGTPEALKCAACDCHRNFHRKEMEGE 187
                    79**************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-23132185IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.7E-32132184IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.3E-32133184IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.506134183IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.02E-11278337IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-22280337IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-21288337IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MPSSLGYNPP IRESSSKVSS HPVISTGLVG GERRRDGTGN GTAILNPSQT QTLDHLQQHH  60
HHRLHQPQGH GRNPDPADSD PVPVAIAVSG ATSAPVAGGS NSARTTPPPP PLPPPPTTAT  120
ISTTTKSTAT AVRYRECLKN HAASIGGHVV DGCGEFMPSG EEGTPEALKC AACDCHRNFH  180
RKEMEGESQS GANCYYYHNK NYDGSRSRIP PPQPQLPPPP LQQHQKFQLG LPTSPSPGSI  240
PPMMMMAFGG GGGIGGGATE SSSEDLNAYQ SSAPGGATQP PQPLSLSKKR FRTKFTQEQK  300
DRMLEFAEKI GWKIQKQDEP EVQQFCAEVG VKRQVLKDDH HSSACLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-192873371666ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010254805.10.0PREDICTED: zinc-finger homeodomain protein 5-like
RefseqXP_010254806.10.0PREDICTED: zinc-finger homeodomain protein 5-like
RefseqXP_010254807.10.0PREDICTED: zinc-finger homeodomain protein 5-like
SwissprotQ9FRL51e-57ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLA0A068U3221e-91A0A068U322_COFCA; Uncharacterized protein
STRINGVIT_04s0023g01880.t018e-81(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.25e-50homeobox protein 31